Table 1.

Sequence comparisons of amino acids encoded by PROPEP1 paralogs

Paralogs*Residues C-terminal alignments
1 10 23
At5g6490092-ATKVKAKQRGKEKVSSGRPGQHN
At5g64890109-DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED
At5g6490596-EIKARGKNKTKPTPSSGKGGKHN
At5g0998081-GLPGKKNVLKKSRESSGKPGGTNKKPF
At5g0999086-SLNVMRKGIRKQPVSSGKRGGVNDYDM
At2g22000104-ITAVLRRRPRPPPYSSGRPGQNN
Unannotated75-VSGNVAARKGKQQTSSGKGGGTN
  • The 23-aa sequence of AtPep1 is aligned with the C termini deduced from its six known paralogs.

  • *Gene locus identification numbers.

  • Total amino acids deduced for each proprotein.