Table S1.

Clones obtained in domain-specific human and mouse GPR56 monobody engineering campaign

Full clone nameAbbreviated clone nameSequence
Mb(hGPR56_β1)β1VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETGGWWYAAQEFTVPGSKSTATISGLKPGVDYTITVYAYPDHHYQGRSPISINYRT
Mb(hGPR56_β2)β2VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYIITYGETGGSWYSSQEFAVPGSKSTATISGLKPGVDYTITVYASMPGSWYYSPISINYRT
Mb(hGPR56_β3)β3VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETGSGWFPGQTFEVPGSKSTATISGLKPGVDYTITVYTYGYSSLGPGSPISINYRT
Mb(hGPR56_β4)β4VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETGHGWFPGQTFEVPGSKSTATISGLKPGVDYTITVYAFYPRSSRPSPISINYRT
Mb(hGPR56_β5)β5VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGVGWVPGQTFTVPGSKSTATISGLKPGVDYTITVYAWNASIFSYSPISINYRT
Mb(hGPR56_β6)β6VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGVGWVPGQTFTVPGSKSTATISGLKPGVDYTITVYAYSEWSYFVINPISINYRT
Mb(hGPR56_β7)β7VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYVITYGETGHGGYYYQEFKVPGSKSTATISGLKPGVDYTITVYAYDDEYSSSPISINYRT
Mb(hGPR56_β8)β8VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYYITYGETGWWYPSSYQEFAVPGSKSTATISGLKPGVDYTITVYAESGWGYDVSSPISINYRT
Mb(hGPR56_β9)β9VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGGSWYGWQEFAVPGSKSTATISGLKPGVDYTITVYAYPDHHYQGRSPISINYRT
Mb(mGPR56_β10)β10VSSVPTKLEVVAATPTSLLISWDAPAVTVFFYFITYGETGGNSPVQKFTVPGSKSTATISGLKPGVDYTITVYALYRSQKSGQYDYSSPISINYRT
Mb(mGPR56_β11)β11VSSVPTKLEVVAATPTSLLISWDAPAVTVVLYVITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAQYESGTWLYRGSPISINYRT
Mb(mGPR56_β12)β12VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYFITYGETGWGYGSYQAFEVPGSKSTATISGLKPGVDYTITVYAYYYDSQRFLHSGSPISINYRT
Mb(mGPR56_β13)β13VSSVPTKLEVVAATPTSLLISWDASSSSVSYYRITYGETGGNSPVQEFTVPGSSSTATISGLKPGVDYTITVYAQSGPYYWYWGDSPISINYRT
Mb(hGPR56_β14)β14VSSVPTKLEVVAATPTSLLISWDATGYYVRYYRITYGETGGNSPVQEFTVPGSSSTATISGLKPGVDYTITVYAQSGPYYWYWGDSPISINYRT
Mb(mGPR56_β15)β15VSSVPTKLEVVAATPTSLLISWDASSSSVSYYRITYGETGGNSPVQEFTVPGSSSTATISGLKPGVDYTITVYAGVGNYKYWWGSSPISINYRT
Mb(hGPR56_β16)β16VSSVPTKLEVVAATPTSLLISWDANYYYSYGDVIYYRITYGETGGNSPVQEFTVPYYYSTATISGLKPGVDYTITVYAYDEYYTYGWSSPISINYRT
Mb(mGPR56_β17)β17VSSVPTKLEVVAATPTSLLISWDAMKNDEDVQYYRITYGETGGNSPVQEFTVPGSSSTATISGLKPGVDYTITVYAGVSSYYYYWGSSPISINYRT
Mb(hGPR56_β18)β18VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGVGWVPGQTFEVPGSKSTATISGLKPGVDYTITVYAYHEYYFISPISINYRT
Mb(hGPR56_β19)β19VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYYITYGETGSSYWSYQEFTVPGSKSTATISGLKPGVDYTITVYAIDQWQYYYYEMGSPISINYRT