Table 1

Peptides used to define the active region of histone H2A

SequenceTransfection
ControlHistone H2A++
1S1 GRGKQGGKARAKAKTR17
2S18 SRAGLQFPVGRVHRLL34*
3R35 KGNYAERVGAGAPVYL51
4A52 AVLEYLTAEILELAGN68
5A69 ARDNKKTRIIPRHLQ84
6L85 AIRNDEELNKLLGK99
7V100 TIAQGGVLPNIQAV114
8L115 LPKKTESHHKAKGK129
9S1 GRGK QGGKA RAKAK TRSSR AGLQF PVGRV HRLLR KG37+
10S1GRGK QGGKA RAKAK TRSSR AGLQF PVGRV HRLLR K36W+
11S1GRGK QGGKA RAKAK TRSSR AGLQF P26
12S1GRGK QGGKA RAKAK TRSSR AGLQ24W
13Q24FPVGRVHRLLRK36W
14V27GRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDN73
15E91ELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK129
16P117KKTESHHKAKGK129W
17S1GRGK QGGKA RAKAK TRSSR AGLQFP117KKTESHHKAKGK129 W
18S1GRGK QGGKA RAKAK TRSSR AGLQF GVGRV HRLLR KG37
19S1GRGK QGGKA RAKAK TRSSR AGLQF PVGRP HRLLR KG37
20S1G SGS QGGSA SASAS TSSSS AGLQF PVGRV HRLLR KG37
21S1GRGK QGGKA RAKAK TRSSR AGLQF PVG SV HS LLS S G37
22S1GRGK QGGSA SASAS TSSSS AGLQF PVGRV HRLLR KG37
23PKKKRKVV27GRVHRLLRKG37
24PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKV27GRVHRLLRKG37
25ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGV27GRVHRLLRKG37
26SGRGKGGKGLGKGGAKRHRKVLRDNIQGITV27GRVHRLLRKG37
27S1GRGK QGGKA RAKAK TRSSR AGLQF P26 KESY SVYVY KVL
28S1GRGK QGGKA RAKAK TRSSR AGLQF P26 TVAL REIRR YQK
29S1GRGK QGGKA RAKAK TRSSR AGLQF P26 KPAI RRLAR R
  • Portions of peptides that contain histone H2A sequences are designated by superscript numbering of the corresponding region of histone H2A. Transfection activity is defined as in the Fig. 1 legend. The underlined bold font of the sequence of peptide 9 corresponds to its DNA contact sites, as illustrated and described in the Fig. 2 legend. The bold font used for parts of peptides 18–22 represent amino acid substitutions in the sequence of peptide 9. Peptides 23–26 represent amino acids 27–37 of histone H2A preceded by the simian virus 40 nuclear localization signal (16, 17) and the N-terminal sequences of histone H2B, H3, and H4, respectively. Peptides 27–29 represent amino acids 1–26 of histone H2A followed by the sequence of the first α-helix of histone H2B, H3, and H4, respectively. The asterisk (*) for the transfection activity of peptide 2 indicates that there was only background transfection activity in the initial screening with this peptide. Peptide 2 can mediate transfection when high concentrations (1,000–2,000 μM) are used in contrast to peptides 1 and 3–8, which yield only background levels of transfection even under these conditions.