Table 1

P. aeruginosa genes encoding proteins that are secreted by the TAT apparatus

FunctionEncoded proteinCellular locationSignal sequence*Homologs in other bacteria
Phospholipases
plcHPhospholipase CExtracellular MTENWKFRRRTFLKHGAQAATLAGLSGLFPETLRRALA M. tuberculosis,
plcNPhospholipase CExtracellular MISKSRRSFIRLAAGTVGATVATSMLPSSIQAALA Burkholderia cepacia, B. pseudomallei
Iron acquisition
fpvAFerripyoverdine receptorOuter membrane MPAPHGLSPLSKAFLMRRAFQRRILPHSLAMALSLPLAGYVQA M. tuberculosis
 PA2394Pyoverdine biosynthesisPeriplasmic MNDRRTFLKQAGILAAGLPLLSAAQSLRAEG Pseudomonas putida, P. syringae
 PA2389Pyoverdine biosynthesisPeriplasmic MRRTRSTRRALLVAVCLSPLIALA
 PA2392Pyoverdine biosynthesisPeriplasmic MTVSRRGFMAGLALTGAAALPVAYY
Anaerobic growth
napANitrate reductasePeriplasmic MNLTRREFAKANAAAIAAAAAGLPILVRASNLVTEADV Bordetella parapertussis, Yersinia
napFFerredoxinPeriplasmic MSSRRELFRRLGGHPPTRRPPWTAADFAAG enterocolitica, Vibrio cholerae,
nosZNitrous oxide reductasePeriplasmic MSDDTKSPHEETHGLNRRGFLGASALTGAAALVGASA Salmonella enterica serovar Typhi, E. coli, Haemophilus ducreyi
Catabolism
fdnGFormate dehydrogenase MDMNRRQFFKVCGIGLGGSSLAALGMAPTEAFA S. enterica serovar Typhi,
 PA2124DehydrogenasePeriplasmic? MHQPENPARRTLLAQTVAGSAALALGSLLGGAPGVASA E. coli
 PA2264DehydrogenasePeriplasmic? MPDDKAVNGRRDFLRKTLTVIPAVTLAGYGVG Yersinia pestis
 PA4621Aldehyde oxidasePeriplasmic? MSNRDISRRAFLQGGLIAGVGVTLAPLGSQAFA Haemophilus influenzae
 PA1601Aldehyde oxidasePeriplasmic? MSLANPSRRGFLKAGGLLLVTVNLPAPLLALA
 PA1880Aldehyde oxidasePeriplasmic? MNSKIDLSNALPGSRRGFLKGAAVVGLTIGFQWSGARRALA
 PA2378Aldehyde oxidasePeriplasmic? MKRSYPDDLVIGNLSRRGFLKGVGATGVLLVAANWGWRDALA
Others
copAMulticopper oxidasePeriplasmic MHRTSRRTFVKGLAATGLLGGLGLWRAPAWA Caulobacter crescentus,
 PA0144unknownunknown MSRSNGSSSRRTFLRLAALLLPAGALLGSLPGVRAAA  B. parapertussis
  • * The twin-arginine recognition motif (consensus RRXFLK) is underlined. 

  • The listed species have predicted TAT-dependent homologs based on their genome sequence; however, experimental data are not available.